PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539047.1_FGP011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARF
Protein Properties Length: 727aa    MW: 80131 Da    PI: 5.8727
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539047.1_FGP011genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.54.4e-22185285198
                        EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                        f+k+ltpsd++++g +++ +++a+e+       +     +++l+ +d++g +W++k+iyr++++r++lt+GW+ Fv +++L +gD +v    
  KN539047.1_FGP011 185 FCKILTPSDTSTHGGFSVLRRHANEClppldmsMAT--PTQELITKDLHGSEWRFKHIYRGQPRRHLLTTGWSTFVTSKKLISGDAFVYL-- 272
                        99****************************974333..3458999******************************************999.. PP

                        SSSEE..EEEEE- CS
                 B3  86 grsefelvvkvfr 98 
                        +++++e +v+v+r
  KN539047.1_FGP011 273 RSETGEQRVGVRR 285
                        4477778999997 PP

2Auxin_resp96.83.1e-32311392183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        a+ha++t+s+F v+Y+Pr s+s+++v+v+k+++a kv + vGmRfkm+fe+ed++ +++sGt+vg  d  +++W++S+W+sLk
  KN539047.1_FGP011 311 ASHAIKTNSIFLVYYRPRLSQSQYIVSVNKYLAASKVGFNVGMRFKMSFEGEDVPVKKFSGTIVGEGD-LSLQWSGSEWKSLK 392
                        789*****************************************************************.566*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.1E-37176314IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.9E-36177300IPR015300DNA-binding pseudobarrel domain
CDDcd100172.83E-16183285No hitNo description
SMARTSM010191.1E-16185287IPR003340B3 DNA binding domain
PROSITE profilePS5086311.138185287IPR003340B3 DNA binding domain
PfamPF023621.0E-19185285IPR003340B3 DNA binding domain
PfamPF065077.5E-29311392IPR010525Auxin response factor
PfamPF023091.0E-6612660IPR033389AUX/IAA domain
SuperFamilySSF542771.62E-9618696No hitNo description
PROSITE profilePS5174524.91623712IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2401.7E-4625688No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 727 aa     Download sequence    Send to blast
MSSQGDALPL VLVLFILFCL PGGGGLMVGG GAHAGGGGGV GDPELFAELW RACAGPLVEV  60
PQRDERVFYF LQGHLEQLQE PTDPALLAEQ IKMFQVPYKI LCKVVNVELK AETETDEVFA  120
QITLQPDPDR PFLLKVNLLD VYFGSHCVIC RIGPEKAAIL GLQENLPTLP DPPLPEQPRP  180
VVHSFCKILT PSDTSTHGGF SVLRRHANEC LPPLDMSMAT PTQELITKDL HGSEWRFKHI  240
YRGQPRRHLL TTGWSTFVTS KKLISGDAFV YLRSETGEQR VGVRRLVQKQ STMPASVISS  300
QSMHLGVLAS ASHAIKTNSI FLVYYRPRLS QSQYIVSVNK YLAASKVGFN VGMRFKMSFE  360
GEDVPVKKFS GTIVGEGDLS LQWSGSEWKS LKVQWDEVTN VNGPERVSPW EIETCDGTAP  420
AINVPLQSAT KNKRPREPSE TLDLQSLGEH PGYGAVSSSS VCQNPLVLES WLKDFNSSNK  480
GVSPTLSEIS QKLFQVTSNE ARIATWPARA AYQAEEPTSK LSSNTAVCGY QTEEVAPNAS  540
KVVEGKKEPA MFRLFGVDLM KCTSISTTTD DKSSVGAGET SAKGTGSHED SGQLSAFSKV  600
TKEHIAADES PREIQSHQNY TGRTRIKVQM HGNAVGRAVD LANLDGYEQL MNELEEMFNI  660
KDLKQKWKVA FTDDEGDTME VGDDPWLEFC QMVRKIVLYP IEDEKKIEPH LKLLSSANPE  720
QDQKTGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-146274131353Auxin response factor 1
4ldw_A1e-146274131353Auxin response factor 1
4ldw_B1e-146274131353Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0713000.0AB071300.1 Oryza sativa OsARF16 mRNA for auxin response factor 16, partial cds.
GenBankAK1025210.0AK102521.1 Oryza sativa Japonica Group cDNA clone:J033095P08, full insert sequence.
GenBankEU8470080.0EU847008.1 Oryza sativa Japonica Group clone KCS385B05 auxin response factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622434.10.0PREDICTED: auxin response factor 1 isoform X1
SwissprotQ5NB850.0ARFA_ORYSJ; Auxin response factor 1
TrEMBLA0A0E0BZN80.0A0A0E0BZN8_9ORYZ; Auxin response factor
STRINGORGLA01G0077700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108236116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18